PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_6525.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 312aa    MW: 33634.6 Da    PI: 10.102
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_6525.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP721.1e-22174221148
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                  +Cqve+C+adls ak+yhrrhkvCe h+ka+ v ++g++qrfCqqCsr
  MLOC_6525.2 174 RCQVEDCKADLSGAKHYHRRHKVCEYHAKAALVSTAGKQQRFCQQCSR 221
                  6**********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.0E-24167221IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.281172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-22173222IPR004333Transcription factor, SBP-box
PfamPF031103.2E-18175221IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MMSGGRMNGP ASDDFPFGAM QPPPYVGFEH AGGGGGQRHQ GAMMYDNFDF AVAAAAFGQF  60
QDAPHHQMLA MPPNGSGAGG LVPMAPPPMP MPGMQLQMPP MPHGMHGHGD VCPSMGMVKR  120
EGGAGDAGRI GLNLGRRTYF SPGDMMAVDR VLMRSRLGGV FGLGFGRAHQ QAPRCQVEDC  180
KADLSGAKHY HRRHKVCEYH AKAALVSTAG KQQRFCQQCS RSVNPTSHST VSLPLQKRNE  240
STAERTWSVY STTYSRARLQ IVQARPVKTA CLFSLHSVFG SCRLSVAAAM ARKRVCAKAS  300
LSLRDDRSCQ IQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-15175221652squamosa promoter-binding protein-like 12
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3764430.0AK376443.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3124E22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.15e-64PREDICTED: squamosa promoter-binding-like protein 10
SwissprotA2YFT91e-56SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE81e-56SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLM0Y2Y20.0M0Y2Y2_HORVD; Uncharacterized protein
STRINGMLOC_6525.11e-162(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.23e-29squamosa promoter binding protein-like 8